DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and Prss27

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:276 Identity:107/276 - (38%)
Similarity:150/276 - (54%) Gaps:26/276 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   780 EGVDYKEVCGR-RMFPEPRIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNENWAITAAHC 843
            ||.:....||. |||  .|:|||.:|..|.||||:|:::    ...|.||.:|:...|.:|||||
  Rat    21 EGAEAMRACGHPRMF--NRMVGGEDALEGEWPWQVSIQR----NGAHFCGGSLIAPTWVLTAAHC 79

  Fly   844 VDNVPPSDLLL---RLGEYDLAEEEEPYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVIFQ 905
            ..|.  ||:.:   .||...| ::..|:.... .|:.|.|||::.......|:||:....||.|.
  Rat    80 FSNT--SDISIYQVLLGALKL-QQPGPHALYV-PVKRVKSHPEYQGMASSADVALVELQVPVTFT 140

  Fly   906 PNIIPVCVPDNDENF-IGQTAFVTGWGRLYEDG--PLPSVLQEVAVPVINNTICESMYRSAG--- 964
            ..|:|||:||....| .|...:|||||...|..  |.|.:||::|||:|:...|..:|....   
  Rat   141 KYILPVCLPDPSVVFKSGMNCWVTGWGSPSEQDRLPNPRILQKLAVPLIDTPKCNLLYSKDAEAD 205

  Fly   965 -YIEHIPHIFICAGWKKGGYDSCEGDSGGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRI 1028
             .::.|....:|||:.:|..|:|:||||||:|..  .|:.:...||||||.|||..|:||||.|:
  Rat   206 IQLKTIKDDMLCAGFAEGKKDACKGDSGGPLVCL--VDQSWVQAGVISWGEGCARRNRPGVYIRV 268

  Fly  1029 SEFRDWINQI---LQF 1041
            :....||:||   |||
  Rat   269 ASHYQWIHQIIPELQF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 93/247 (38%)
Tryp_SPc 798..1038 CDD:238113 94/249 (38%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 93/247 (38%)
Tryp_SPc 39..278 CDD:238113 94/248 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.