DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and Tmprss5

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_695223.2 Gene:Tmprss5 / 266681 RGDID:628625 Length:445 Species:Rattus norvegicus


Alignment Length:325 Identity:111/325 - (34%)
Similarity:162/325 - (49%) Gaps:49/325 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   729 SDLAASSSSSTTTTTSSPTTAAETTDYSGEEPNTTTIEATGSTTVAPANALEGVDYKEVCGRRMF 793
            ||:..:.|......::.|.:..|              ||...:|..|:..:..:...| ||.|..
  Rat   155 SDIKLNRSQEFAQLSARPGSLVE--------------EAWQPSTNCPSGRIVSLKCSE-CGARPL 204

  Fly   794 PEPRIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNENWAITAAHCVDNVPPSDLLLRLGE 858
            .. |||||...|.||||||.|:.....    |.|||::|...|.:|||||:    .|..|.||..
  Rat   205 AS-RIVGGQAVASGRWPWQASVMLGSR----HTCGASVLAPYWVVTAAHCM----YSFRLSRLSS 260

  Fly   859 Y----DLAEEEEPYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCVPDNDEN 919
            :    .|........:|...|:.:..||.:..:..:||:|||:...|:.|...:..||:|..:::
  Rat   261 WRVHAGLVSHSAVRQHQGTMVEKIIPHPLYSAQNHDYDVALLQLRTPINFSDTVSAVCLPAKEQH 325

  Fly   920 F-IGQTAFVTGWGRLYEDGPLPS------VLQEVAVPVINNTICES--MYRSAGYIEHIPHIFIC 975
            | .|...:|:|||  :.|   ||      .||:..||:::..:|.|  ||..|     :.|..:|
  Rat   326 FPQGSQCWVSGWG--HTD---PSHTHSSDTLQDTMVPLLSTDLCNSSCMYSGA-----LTHRMLC 380

  Fly   976 AGWKKGGYDSCEGDSGGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDWINQILQ 1040
            ||:..|..|:|:||||||:|.  .|...:||.||:|||.||||.|:||||.:::||.|||:..:|
  Rat   381 AGYLDGRADACQGDSGGPLVC--PSGDTWHLVGVVSWGRGCAEPNRPGVYAKVAEFLDWIHDTVQ 443

  Fly  1041  1040
              Rat   444  443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 95/250 (38%)
Tryp_SPc 798..1038 CDD:238113 96/252 (38%)
Tmprss5NP_695223.2 SRCR_2 106..203 CDD:406055 12/62 (19%)
Tryp_SPc 208..441 CDD:238113 96/252 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.