DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and Klkb1

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:298 Identity:106/298 - (35%)
Similarity:162/298 - (54%) Gaps:32/298 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   752 TTDYSGEEPNTTTIEATGST--TVAPANALEGVDYKEVCGRRMFPEPRIVGGANAAFGRWPWQIS 814
            :||.|   |...|.||.||:  ::.....:|..|    |..::  ..|||||.|::.|.||||:|
  Rat   352 STDGS---PTRITYEAQGSSGYSLRLCKVVESSD----CTTKI--NARIVGGTNSSLGEWPWQVS 407

  Fly   815 LRQWRTSTYLHKCGAALLNENWAITAAHCVDNVPPSDL------LLRLGEYDLAEEEEPYGYQER 873
            | |.:..:..|.||.:::...|.:|||||.|.:|..|:      :|.|.|   ...:.|:.    
  Rat   408 L-QVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSE---ITNKTPFS---- 464

  Fly   874 RVQIVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCVPDN-DENFIGQTAFVTGWGRLYEDG 937
            .::.:..|.::......||:||::...|:.:.....|:|:|.. |.|.|....:|||||...|.|
  Rat   465 SIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERG 529

  Fly   938 PLPSVLQEVAVPVINNTICESMYRSAGYIEHIPHIFICAGWKKGGYDSCEGDSGGPMVLQRESDK 1002
            ...::||:..:|::.|..|:..||.  |:  |....||||:|:||.|:|:||||||:|.:...  
  Rat   530 ETQNILQKATIPLVPNEECQKKYRD--YV--ITKQMICAGYKEGGIDACKGDSGGPLVCKHSG-- 588

  Fly  1003 RFHLGGVISWGIGCAEANQPGVYTRISEFRDWINQILQ 1040
            |:.|.|:.|||.|||...||||||:::|:.|||.:.:|
  Rat   589 RWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQ 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 91/244 (37%)
Tryp_SPc 798..1038 CDD:238113 92/246 (37%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519 9/25 (36%)
Tryp_SPc 390..621 CDD:214473 91/244 (37%)
Tryp_SPc 391..621 CDD:238113 90/243 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9079
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.