DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and CG30091

DIOPT Version :10

Sequence 1:NP_610437.2 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:147 Identity:34/147 - (23%)
Similarity:58/147 - (39%) Gaps:33/147 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KIRKAIDTVQDSFYVAFSIEKLIVSSSASGPFLQRIATLTEQISYMAYKDPLEELFIIQC--ALT 70
            :||:.:||        |:......::||....|..:|...| |....|::.:.|:....|  :|.
  Fly   296 EIREEVDT--------FTFAGHDTTASAMTFILYNVAKHPE-IQERVYQEIVNEIGADFCELSLR 351

  Fly    71 ALRLEVL--VNNPKLTTIDLTRNRIRQLFPITTPPKTKLSVTSLSLVANQ-------------LE 120
            |:.|..|  :||  |..::|......:||| ..|...:::.....|:|.:             :.
  Fly   352 AICLHTLSALNN--LHYMELVIKESLRLFP-PVPVIARIATEDTELLAERITRGTSVAIDIYTMH 413

  Fly   121 HLDMSMFAFMPKLELFD 137
            |.|    .:.|..|.||
  Fly   414 HSD----DYFPDAERFD 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_610437.2 Tryp_SPc 798..1038 CDD:238113
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473
Tryp_SPc 332..520 CDD:473915 23/102 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.