DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and Tmprss4

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_663378.1 Gene:Tmprss4 / 214523 MGIID:2384877 Length:435 Species:Mus musculus


Alignment Length:359 Identity:103/359 - (28%)
Similarity:171/359 - (47%) Gaps:53/359 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   709 EAPASSIELASSTSSYTDLGSDLAASSSSST---TTTTSSPTTAAETTDYSGE----------EP 760
            |.|..::.|:...|:...|  |.|..:.:|.   ..|.:...||.....|..:          :.
Mouse    96 EKPGVAVRLSKDRSTLQVL--DAATGTWASVCFDNFTEALAKTACRQMGYDSQPAFRAVEIRPDQ 158

  Fly   761 NTTTIEATGSTTVAPAN------------ALEGVDYKEVCGRRMFPEPRIVGGANAAFGRWPWQI 813
            |....:.||::......            :|..:|    ||:.: ..||:|||..|....||||:
Mouse   159 NLPVAQVTGNSQELQVQNGSRSCLSGSLVSLRCLD----CGKSL-KTPRVVGGVEAPVDSWPWQV 218

  Fly   814 SLRQWRTSTYLHKCGAALLNENWAITAAHCVDN-VPPSDLLLRLGEYDLAEEEE-PYGYQERRVQ 876
            |::..:.    |.||.::|:.:|.:|||||... :..|...:|.|...|..... |..    ::.
Mouse   219 SIQYNKQ----HVCGGSILDPHWILTAAHCFRKYLDVSSWKVRAGSNILGNSPSLPVA----KIF 275

  Fly   877 IVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCVPDNDENFIGQT-AFVTGWGRLYED-GPL 939
            |...:|.: |:  |.|:||::...|:.|..::.|:|:|.:||..:..| .:|.|||...|: |.:
Mouse   276 IAEPNPLY-PK--EKDIALVKLQMPLTFSGSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKM 337

  Fly   940 PSVLQEVAVPVINNTICESMYRSAGYIEHIPHIFICAGWKKGGYDSCEGDSGGPMVLQRESDKRF 1004
            ..:|.:.:|.||::|.|.:   ...|...:....:|||..:||.|:|:||||||  |...||| :
Mouse   338 SDMLLQASVQVIDSTRCNA---EDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGP--LMYHSDK-W 396

  Fly  1005 HLGGVISWGIGCAEANQPGVYTRISEFRDWINQI 1038
            .:.|::|||.||...:.|||||:::.:.:||..:
Mouse   397 QVVGIVSWGHGCGGPSTPGVYTKVTAYLNWIYNV 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 81/241 (34%)
Tryp_SPc 798..1038 CDD:238113 82/243 (34%)
Tmprss4NP_663378.1 LDLa 56..90 CDD:238060
SRCR_2 106..195 CDD:295335 14/94 (15%)
Tryp_SPc 202..427 CDD:214473 81/241 (34%)
Tryp_SPc 203..430 CDD:238113 82/243 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.