DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and try-1

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:297 Identity:98/297 - (32%)
Similarity:143/297 - (48%) Gaps:61/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   765 IEATG----STTVAPA---NALEGVDYKEVCGRRMFPEPRIVGGANAAFGRWPWQISLRQWRTST 822
            ||..|    ||.|..|   :|.|..||..:       :.|::||:.::...|||.:.|   .:..
 Worm    25 IEKVGCGLHSTNVELAQTRSAQEPADYVTL-------DHRLIGGSESSPHSWPWTVQL---LSRL 79

  Fly   823 YLHKCGAALLNENWAITAAHCVDNVPPSDLLLRLGEYDLAEEEEPYGYQER------------RV 875
            ..|:||.:|::.|:.:|||||                 .|::..|..|..|            ||
 Worm    80 GHHRCGGSLIDPNFVLTAAHC-----------------FAKDRRPTSYSVRVGGHRSGSGSPHRV 127

  Fly   876 QIVASHPQFD---PRTFEYDLALLRFYEPVIFQPNIIPVCVPDND--ENFIGQTAFVTGWGRLYE 935
            ..|:.||.::   |.:  ||.|::|.:.||.......|:|:|...  ||   :...|||||...|
 Worm   128 TAVSIHPWYNIGFPSS--YDFAIMRIHPPVNTSTTARPICLPSLPAVEN---RLCVVTGWGSTIE 187

  Fly   936 DGPLPS-VLQEVAVPVINNTICESMYRSAGYIEHIPHIFICAGWKKGGYDSCEGDSGGPMVLQRE 999
            ...|.: .|:|:.||:::...|.|:....|.| |:|.: :|||:..|..|||:||||||::..| 
 Worm   188 GSSLSAPTLREIHVPLLSTLFCSSLPNYIGRI-HLPSM-LCAGYSYGKIDSCQGDSGGPLMCAR- 249

  Fly  1000 SDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDWIN 1036
             |..:.|.||:|||||||....||||..:.....|||
 Worm   250 -DGHWELTGVVSWGIGCARPGMPGVYGNVHSASTWIN 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 84/255 (33%)
Tryp_SPc 798..1038 CDD:238113 86/257 (33%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 84/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.