DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and PRSS21

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:262 Identity:102/262 - (38%)
Similarity:147/262 - (56%) Gaps:19/262 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   788 CGRRMFPEPRIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNENWAITAAHCV----DNVP 848
            ||||:... |||||.:|..||||||.|||.|.:    |.||.:||:..||:|||||.    |...
Human    33 CGRRVITS-RIVGGEDAELGRWPWQGSLRLWDS----HVCGVSLLSHRWALTAAHCFETYSDLSD 92

  Fly   849 PSDLLLRLGEYDLAEEEEPYGYQERRVQIVASHPQFDPR---TFEYDLALLRFYEPVIFQPNIIP 910
            ||..:::.|:  |......:..|....:...|:....||   ...||:||::...||.:..:|.|
Human    93 PSGWMVQFGQ--LTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQP 155

  Fly   911 VCVPDNDENFIGQT-AFVTGWGRLYEDGPLPS--VLQEVAVPVINNTICESMYRSAGYIEHIPHI 972
            :|:..:...|..:| .:|||||.:.||..|||  .||||.|.:|||::|..::....:.:.|...
Human   156 ICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGD 220

  Fly   973 FICAGWKKGGYDSCEGDSGGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDWINQ 1037
            .:|||..:||.|:|.||||||:...:..  .::..||:|||:||...|:|||||.||...:||.:
Human   221 MVCAGNAQGGKDACFGDSGGPLACNKNG--LWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQK 283

  Fly  1038 IL 1039
            ::
Human   284 LM 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 96/247 (39%)
Tryp_SPc 798..1038 CDD:238113 97/249 (39%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 97/248 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40690
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.