DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and Prss50

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:XP_017451624.2 Gene:Prss50 / 100910205 RGDID:6499372 Length:424 Species:Rattus norvegicus


Alignment Length:394 Identity:93/394 - (23%)
Similarity:149/394 - (37%) Gaps:117/394 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   685 PKPSSTAKPTTTTTAAATTIVKTTEAPASSIELASSTSSYTDLGSDLAASSSSSTTTTTSSPTTA 749
            |...|||.||....:.|::.:    .|:..:.|...             ..:|.|:.||:.|...
  Rat    73 PATLSTAVPTGPRASCASSGI----CPSGRLRLPRQ-------------DQTSDTSQTTTPPKGM 120

  Fly   750 AETTDYSGEEPNTTTIEATGSTT-VAPANALEGVDYKEVCGRRMFPEPRIVGGANAAFGRWPWQI 813
            ..          .:|:..|||.: ..|.|.       .:||....|:|.: ....|...||||.:
  Rat   121 GA----------LSTVGITGSVSKTKPGNL-------PLCGSSQEPDPTL-RDPEAMTRRWPWMV 167

  Fly   814 SLRQWRTSTYLHKCGAALLNENWAITAAHCV-----------------------DNVPPSDLLLR 855
            |::    :...|.|...|:...|.:..|||:                       .:||.:.:::.
  Rat   168 SVQ----TNGSHVCAGILIASQWVLAVAHCLSQNRVNYTVRVGSPWINQTTETSSDVPVNQVIIN 228

  Fly   856 LGEYDLAEEEEPYGYQERRV-----QIVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCVPD 915
                        .|||.:|.     :|             :|:.||:....:.:...:.|||:|.
  Rat   229 ------------SGYQSKRYWSWVGRI-------------HDIGLLKLKWGLKYSKYVWPVCLPG 268

  Fly   916 ND---ENFIGQTAFVTGWGRLYEDGPLP--SVLQEVAVPVINNTICESMYRSAGYIEHIPHI--- 972
            .:   |:  |....|||||....:|..|  ..|||..|.::|:..||..|.....|..:..|   
  Rat   269 LEYVVED--GSLCTVTGWGYPKANGLWPQFQTLQEKEVSILNSRECEHYYHKFSRIHSLVRIISP 331

  Fly   973 -FICAGWKKGGYDS-----CEGDSGGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEF 1031
             .|||      .|:     |...||.|:|.  .||..::|.||:|||.||.::..|.::.::|.:
  Rat   332 QMICA------LDNDREKFCYERSGEPLVC--SSDGMWYLVGVMSWGPGCKKSEAPPIFLQVSHY 388

  Fly  1032 RDWI 1035
            :.||
  Rat   389 QLWI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 67/279 (24%)
Tryp_SPc 798..1038 CDD:238113 69/280 (25%)
Prss50XP_017451624.2 Tryp_SPc 162..392 CDD:238113 66/268 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.