DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Np and tmprss3a

DIOPT Version :9

Sequence 1:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster
Sequence 2:XP_021334565.1 Gene:tmprss3a / 100000148 ZFINID:ZDB-GENE-070912-70 Length:543 Species:Danio rerio


Alignment Length:257 Identity:95/257 - (36%)
Similarity:139/257 - (54%) Gaps:27/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   788 CGRRMFPEPRIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNENWAITAAHCVDNVP-PSD 851
            ||.|.....|||||..:|.|::|||:||.....    |.||.:::...|.:||||||..:. |..
Zfish   288 CGSRPKFSARIVGGNLSAEGQFPWQVSLHFQNE----HLCGGSIITSRWILTAAHCVYGIAYPMY 348

  Fly   852 LLLRLGEYDLAEEEEPYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCVPDN 916
            .::..|..:|...    ..:...|:.:..|.::.|:..::|:||::..:|:.|...:.|:|:|:.
Zfish   349 WMVYAGLTELPLN----AVKAFAVEKIIYHSRYRPKGLDHDIALMKLAQPLTFNGMVEPICLPNF 409

  Fly   917 DENF-IGQTAFVTGWGRLYEDGPLPSVLQEVA-VPVINNTICESM-----YRSAGYIEHIPHIFI 974
            .|.| .|:..:::|||.. |||...||.|..| ||:|:|..|...     |.:||        .|
Zfish   410 GEQFEDGKMCWISGWGAT-EDGGDASVSQHCASVPLISNKACSQPEVYQGYLTAG--------MI 465

  Fly   975 CAGWKKGGYDSCEGDSGGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDWIN 1036
            |||:..||.|||:||||||:..  |....:.|.|..|||.||||.|:|||||||::...||:
Zfish   466 CAGYLDGGTDSCQGDSGGPLAC--EDSSIWKLVGATSWGQGCAEKNKPGVYTRITQSLTWIH 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 90/245 (37%)
Tryp_SPc 798..1038 CDD:238113 91/247 (37%)
tmprss3aXP_021334565.1 LDLa 154..186 CDD:238060
SRCR_2 191..292 CDD:317845 2/3 (67%)
Tryp_SPc 298..525 CDD:238113 90/245 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.