DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and TMPRSS11D

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_004253.1 Gene:TMPRSS11D / 9407 HGNCID:24059 Length:418 Species:Homo sapiens


Alignment Length:283 Identity:105/283 - (37%)
Similarity:143/283 - (50%) Gaps:27/283 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1419 STSRTLPTPNLAFHSPSTECGVRPH---VKSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKC 1480
            ||..|..|...|.:....|||..|.   :...||:||..:..|::||||.:|      |...:.|
Human   154 STEITSLTDQAAANWLINECGAGPDLITLSEQRILGGTEAEEGSWPWQVSLR------LNNAHHC 212

  Fly  1481 GGVLITSRYVITAAHC-----QPGFLASLVAVMGEFDISGDLESKRSVTKNVKRVIVHRQYDPAT 1540
            ||.||.:.:::|||||     .|   ...:|..|   ||......|   ..|:.:::|..|..||
Human   213 GGSLINNMWILTAAHCFRSNSNP---RDWIATSG---ISTTFPKLR---MRVRNILIHNNYKSAT 268

  Fly  1541 FENDLALLELDSPVQFDTHIVPICMPNDVADF-TGRMATVTGWGRLKYGGGVPSVLQEVQVPIIE 1604
            .|||:||:.|::.|.|...|..:|:|....:. .|..|.|||||..:|.|.....|::.||.||.
Human   269 HENDIALVRLENSVTFTKDIHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIIS 333

  Fly  1605 NSVCQEMFHTAGHNKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAA 1669
            |.||... |:  :|..||:..||||...|..|:|:||||||||.:.....:.:.|.||.|.:|..
Human   334 NDVCNAP-HS--YNGAILSGMLCAGVPQGGVDACQGDSGGPLVQEDSRRLWFIVGIVSWGDQCGL 395

  Fly  1670 PYLPGVYMRTTFYKPWLRSITGV 1692
            |..||||.|.|.|..|:|..||:
Human   396 PDKPGVYTRVTAYLDWIRQQTGI 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 93/245 (38%)
TMPRSS11DNP_004253.1 SEA 48..143 CDD:279699
Tryp_SPc 186..412 CDD:214473 92/243 (38%)
Tryp_SPc 187..415 CDD:238113 93/245 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BKY1
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.