DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and TPSAB1

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:249 Identity:90/249 - (36%)
Similarity:133/249 - (53%) Gaps:23/249 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1449 IVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHCQPGFLASLVAVMGEFDI 1513
            ||||:.:....:||||.:|..   |.:..:.|||.||..::|:|||||....:..|.|:..:   
Human    31 IVGGQEAPRSKWPWQVSLRVH---GPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQ--- 89

  Fly  1514 SGDLESKRSVTKN----VKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPICMPNDVADF-T 1573
               |..:....::    |.|:|||.|:..|....|:|||||:.||...:|:..:.:|.....| .
Human    90 ---LREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPP 151

  Fly  1574 GRMATVTGWGRLKYGGGVPS--VLQEVQVPIIENSVCQEMFHTAGHN----KKILTSFLCAGYAN 1632
            |....|||||.:.....:|.  .|::|:|||:||.:|...:|...:.    :.:....||||  |
Human   152 GMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAG--N 214

  Fly  1633 GQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWL 1686
            .::|||:||||||||. :.:|.:..||.||.|..||.|..||:|.|.|:|..|:
Human   215 TRRDSCQGDSGGPLVC-KVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 90/249 (36%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 90/249 (36%)
Tryp_SPc 31..267 CDD:214473 89/247 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152908
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.