DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and Prss22

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:274 Identity:89/274 - (32%)
Similarity:143/274 - (52%) Gaps:33/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1435 STECGVRPHVKSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHC--- 1496
            |.:|| :|. :..|||||:.|....:||.|.:.::      ..:.|.|.|:|:|:|:|||||   
Mouse    96 SPDCG-KPQ-QLNRIVGGEDSMDAQWPWIVSILKN------GSHHCAGSLLTNRWVVTAAHCFKS 152

  Fly  1497 ---QPGFLASLVAVMGEFDISGDLESKRSVTKNVKRVIVHRQYD-PATFENDLALLELDSPVQFD 1557
               :|...:.|   :|.:.:..  ...||....:..|:.|.:|. ......|:||:.|:..:||.
Mouse   153 NMDKPSLFSVL---LGAWKLGS--PGPRSQKVGIAWVLPHPRYSWKEGTHADIALVRLEHSIQFS 212

  Fly  1558 THIVPICMPNDVADFTGRM-----ATVTGWGRLKYGGGV--PSVLQEVQVPIIENSVCQEMFHTA 1615
            ..|:|||:|    |.:.|:     ..:.|||.::.|..:  |..||:::||||::.:|:.::...
Mouse   213 ERILPICLP----DSSVRLPPKTDCWIAGWGSIQDGVPLPHPQTLQKLKVPIIDSELCKSLYWRG 273

  Fly  1616 GHNKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTT 1680
            ...:.|....|||||..|::|:|.|||||||:.| .|..:.|.|.:|.|..||....||||....
Mouse   274 AGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQ-VDDHWLLTGIISWGEGCAERNRPGVYTSLL 337

  Fly  1681 FYKPWL-RSITGVK 1693
            .::.|: |.:.||:
Mouse   338 AHRSWVQRIVQGVQ 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 82/254 (32%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 81/253 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3858
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.