DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and CG18735

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:250 Identity:95/250 - (38%)
Similarity:132/250 - (52%) Gaps:23/250 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1448 RIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHCQPGFLASLVAVMGEFD 1512
            |||||:.:....|||.:::   .|.|.|   .||..|:..:|.:|||||..||...|:.|.    
  Fly    82 RIVGGQETEVHEYPWMIML---MWFGNF---YCGASLVNDQYALTAAHCVNGFYHRLITVR---- 136

  Fly  1513 ISGDLESKRS------VTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPICMPNDVAD 1571
               .||..|.      |.:.|.||::|.:|....|::|:||:..:.||:....:.|:|||....:
  Fly   137 ---LLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSEN 198

  Fly  1572 FTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAGYA-NGQK 1635
            :.|:.|.|||||.|..||.:...||||:|||:....|:...:   ...||..:.:||||. .|.|
  Fly   199 YAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNY---GESKITDNMICAGYVEQGGK 260

  Fly  1636 DSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWLRSIT 1690
            |||:||||||:.:......|:|||.||.|..||.|..||||.|...:..|:...|
  Fly   261 DSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 93/246 (38%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 93/244 (38%)
Tryp_SPc 83..314 CDD:238113 93/246 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457814
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.