DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and PRSS8

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:264 Identity:92/264 - (34%)
Similarity:136/264 - (51%) Gaps:30/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1438 CGVRPHVKSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHCQPG--F 1500
            |||.|   ..||.||..:..|.:||||.:   |:.|:   :.|||.|::.::|::||||.|.  .
Human    37 CGVAP---QARITGGSSAVAGQWPWQVSI---TYEGV---HVCGGSLVSEQWVLSAAHCFPSEHH 92

  Fly  1501 LASLVAVMGEFDISGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPICM 1565
            ..:....:|...:  |..|:.:....:|.:|.|..|.....:.|:|||:|..|:.|..:|.|||:
Human    93 KEAYEVKLGAHQL--DSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICL 155

  Fly  1566 PNDVADF-TGRMATVTGWGRLKYGGGVPSV-------LQEVQVPIIENSVCQEMFHTAGHNKK-- 1620
            |...|.| .|...||||||.:     .|||       ||:::||:|....|..:::.....::  
Human   156 PAANASFPNGLHCTVTGWGHV-----APSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPH 215

  Fly  1621 -ILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKP 1684
             :....:||||..|.||:|:|||||||... .:|.:.|.|.||.|..|.|...||||...:.|..
Human   216 FVQEDMVCAGYVEGGKDACQGDSGGPLSCP-VEGLWYLTGIVSWGDACGARNRPGVYTLASSYAS 279

  Fly  1685 WLRS 1688
            |::|
Human   280 WIQS 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 87/253 (34%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 86/250 (34%)
Tryp_SPc 45..284 CDD:238113 87/253 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3380
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.