DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and zgc:100868

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:XP_005164187.1 Gene:zgc:100868 / 554458 ZFINID:ZDB-GENE-040801-33 Length:654 Species:Danio rerio


Alignment Length:260 Identity:100/260 - (38%)
Similarity:143/260 - (55%) Gaps:31/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1438 CGVRPHVKSGRIVGGKGSTFGAYPWQV-LVRESTWLGLFTKNKCGGVLITSRYVITAAHCQP--- 1498
            ||..|  .:.|||||:.:..||:|||| |.|:.:       :.|||.||.:::::|||||.|   
Zfish    28 CGTAP--LNSRIVGGQNAPVGAWPWQVSLQRDGS-------HFCGGSLINNQWILTAAHCFPNPS 83

  Fly  1499 --GFLASL-VAVMGEFDISGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHI 1560
              |.|..| :..:..|:       ..|::..|..:|.|..|:..|.:||:.||:|.|.|.|..:|
Zfish    84 TTGLLVYLGLQKLASFE-------SYSMSSAVSNIIKHPNYNSDTEDNDITLLQLASTVSFSNYI 141

  Fly  1561 VPICM-PNDVADFTGRMATVTGWGRLKYGGGVPS--VLQEVQVPIIENSVCQEMFHTAGHNKKIL 1622
            .|||: .:|...|.|.:..:||||....|..:||  .||||||||:.|..|..::..:    ||.
Zfish   142 RPICLAASDSTFFNGTLVWITGWGNTATGVSLPSPGTLQEVQVPIVGNRKCNCLYGVS----KIT 202

  Fly  1623 TSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWLR 1687
            .:.:|||...|.||||:||||||:| .:....:..:|.||.|..||.|..||||.|.:.|:.|::
Zfish   203 DNMVCAGLLQGGKDSCQGDSGGPMV-SKQGSVWIQSGIVSFGTGCAQPNFPGVYTRVSKYQSWIQ 266

  Fly  1688  1687
            Zfish   267  266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 96/249 (39%)
zgc:100868XP_005164187.1 Tryp_SPc 36..265 CDD:214473 96/247 (39%)
Tryp_SPc 37..267 CDD:238113 96/249 (39%)
Tryp_SPc 331..509 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.