DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and PLAU

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_002649.2 Gene:PLAU / 5328 HGNCID:9052 Length:431 Species:Homo sapiens


Alignment Length:309 Identity:95/309 - (30%)
Similarity:144/309 - (46%) Gaps:67/309 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1412 ANGRKIHSTSRTLPTPNLAFHSPSTECG---VRPHVKSGRIVGGKGSTFGAYPWQVLVRESTWLG 1473
            |:|:|..|     |...|.|     :||   :||..|   |:||:.:|....||        :..
Human   152 ADGKKPSS-----PPEELKF-----QCGQKTLRPRFK---IIGGEFTTIENQPW--------FAA 195

  Fly  1474 LFTKNK-------CGGVLITSRYVITAAHCQPGFL-----ASLVAVMGEFDISGDLESKRSVTKN 1526
            ::.:::       |||.||:..:||:|.||   |:     ...:..:|...::.:.:.:...  .
Human   196 IYRRHRGGSVTYVCGGSLISPCWVISATHC---FIDYPKKEDYIVYLGRSRLNSNTQGEMKF--E 255

  Fly  1527 VKRVIVHRQY--DPATFENDLALLELDSP----VQFDTHIVPICMPNDVAD--FTGRMATVTGWG 1583
            |:.:|:|:.|  |.....||:|||::.|.    .|....|..||:|:...|  | |....:||:|
Human   256 VENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQF-GTSCEITGFG 319

  Fly  1584 R-----LKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAGYANGQKDSCEGDSG 1643
            :     ..|    |..|:...|.:|.:..||:..:   :..::.|..|||.....:.|||:||||
Human   320 KENSTDYLY----PEQLKMTVVKLISHRECQQPHY---YGSEVTTKMLCAADPQWKTDSCQGDSG 377

  Fly  1644 GPLV--LQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWLRSIT 1690
            ||||  ||   ||..|.|.||.|..||....||||.|.:.:.||:||.|
Human   378 GPLVCSLQ---GRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 81/266 (30%)
PLAUNP_002649.2 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 34..57
KR 67..152 CDD:238056 95/309 (31%)
Connecting peptide 152..177 11/34 (32%)
Tryp_SPc 179..422 CDD:238113 81/266 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.