| Sequence 1: | NP_001137622.1 | Gene: | flz / 35902 | FlyBaseID: | FBgn0286782 | Length: | 1693 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_650345.1 | Gene: | CG9631 / 41729 | FlyBaseID: | FBgn0027563 | Length: | 439 | Species: | Drosophila melanogaster |
| Alignment Length: | 47 | Identity: | 15/47 - (31%) |
|---|---|---|---|
| Similarity: | 21/47 - (44%) | Gaps: | 2/47 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 82 LVAGTNRHLTR-LYVENCLLDRIPPTLSNMIELEELLIMQCALTALR 127 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| flz | NP_001137622.1 | PRK11633 | <365..>439 | CDD:236940 | |
| PRK10263 | <547..>1005 | CDD:236669 | |||
| PHA03247 | <792..1096 | CDD:223021 | |||
| Tryp_SPc | 1449..1689 | CDD:238113 | |||
| CG9631 | NP_650345.1 | GD_N | 26..132 | CDD:464985 | 11/32 (34%) |
| Tryp_SPc | 198..436 | CDD:238113 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||