DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and CG9631

DIOPT Version :10

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster


Alignment Length:47 Identity:15/47 - (31%)
Similarity:21/47 - (44%) Gaps:2/47 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LVAGTNRHLTR-LYVENCLLDRIPPTLSNMIELEELLIMQCALTALR 127
            ||.|.::...| :..|||.|....|.: |....|..|:.:||....|
  Fly    11 LVLGASQAENRCVQEENCTLTVDNPGI-NTKSCEGYLMEECACVQRR 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113
CG9631NP_650345.1 GD_N 26..132 CDD:464985 11/32 (34%)
Tryp_SPc 198..436 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.