DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and TMPRSS11F

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_997290.2 Gene:TMPRSS11F / 389208 HGNCID:29994 Length:438 Species:Homo sapiens


Alignment Length:403 Identity:110/403 - (27%)
Similarity:173/403 - (42%) Gaps:114/403 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1306 PKVTTKKPVTRVTTKA--PNKKTSAVSTTTRKPATRRTTVAAKVTTTTRRPATKKPTRRVSSTVK 1368
            |...:.:.:.:...||  .:.||..:|.|..||:.|.|            |...|..|.:     
Human   134 PSTDSAEQIKKKIEKALYQSLKTKQLSLTINKPSFRLT------------PIDSKKMRNL----- 181

  Fly  1369 TTTVSSARPADDEIVDEEDEEDVNPNPSDNEIDQGATLSSYGGANGRKIHSTSRTLPTPNLAFHS 1433
                                                 |:|..|     |..||..:|.|    .|
Human   182 -------------------------------------LNSRCG-----IRMTSSNMPLP----AS 200

  Fly  1434 PSTECGVRPHVKSGRIVGGKGSTF-GAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHC- 1496
            .||:          |||.|:.:.. |.:|||..::   .:|  :.::||..||::.:::||||| 
Human   201 SSTQ----------RIVQGRETAMEGEWPWQASLQ---LIG--SGHQCGASLISNTWLLTAAHCF 250

  Fly  1497 -----QPGFLASLVAVMGEFDISGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQF 1556
                 ...::|:..|.:          :..:|.:||:::|:|..|...|.|||:||::|.:.|:|
Human   251 WKNKDPTQWIATFGATI----------TPPAVKRNVRKIILHENYHRETNENDIALVQLSTGVEF 305

  Fly  1557 DTHIVPICMPNDVADFTGRMAT-VTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNKK 1620
            ...:..:|:|:.......:.:. |||:|.:...|.:.:.|::.:|..|...||         |:|
Human   306 SNIVQRVCLPDSSIKLPPKTSVFVTGFGSIVDDGPIQNTLRQARVETISTDVC---------NRK 361

  Fly  1621 ------ILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRT 1679
                  |....||||:..|:.|:|:||||||||....|..| :.|.||.|..||.|..||||.|.
Human   362 DVYDGLITPGMLCAGFMEGKIDACKGDSGGPLVYDNHDIWY-IVGIVSWGQSCALPKKPGVYTRV 425

  Fly  1680 TFYKPWLRSITGV 1692
            |.|:.|:.|.||:
Human   426 TKYRDWIASKTGM 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 81/253 (32%)
TMPRSS11FNP_997290.2 SEA 59..154 CDD:279699 3/19 (16%)
Tryp_SPc 205..432 CDD:214473 81/251 (32%)
Tryp_SPc 206..435 CDD:238113 81/253 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.