DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and CG6462

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:262 Identity:80/262 - (30%)
Similarity:121/262 - (46%) Gaps:37/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1448 RIVGGKGSTFGAYPWQV-LVRESTWLGLFTKNKCGGVLITSRYVITAAHCQPGFLASLVAVMGEF 1511
            ||.||:.:|.|.:|:|| ||.:.:...|.   ||||.|||.::|:|||||....:|:.:......
  Fly    76 RIAGGELATRGMFPYQVGLVIQLSGADLV---KCGGSLITLQFVLTAAHCLTDAIAAKIYTGATV 137

  Fly  1512 --DISGDLESKRSVTKNVKRVIVHRQY----DPATF--ENDLALLELDSPVQFDTHIVPICMPND 1568
              |:...:|..:         :.||.:    |...|  .:||||:.|...|:....:.||.:..:
  Fly   138 FADVEDSVEELQ---------VTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGE 193

  Fly  1569 VAD---FTGRMATVTGWGRLKYGGGVPS---VLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLC 1627
            ...   ..|::.|::|||.|  |.....   :||.:...:|:...|...|.....:::   ..||
  Fly   194 FMHQNFLVGKVVTLSGWGYL--GDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQR---RHLC 253

  Fly  1628 AGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIK--CAAPYLPGVYMRTTFYKPWLRSIT 1690
            ...:|| :.:|.||||||:|....:..| |.|..|.|..  |.... |.||.|.|.|.||:|..|
  Fly   254 TDGSNG-RGACNGDSGGPVVYHWRNVSY-LIGVTSFGSAEGCEVGG-PTVYTRITAYLPWIRQQT 315

  Fly  1691 GV 1692
            .:
  Fly   316 AM 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 78/256 (30%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 77/254 (30%)
Tryp_SPc 77..314 CDD:238113 78/256 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457804
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.