DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and CG14990

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:297 Identity:90/297 - (30%)
Similarity:140/297 - (47%) Gaps:32/297 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1404 ATLSSYGGANG--RKIHSTSRTLPTPN--LAFHSPSTECGVRPHVKSGRIVGGKGSTFGAYPWQV 1464
            ||..:.|||.|  ..:..|....|.||  ....:|:   |:..:||    |....||.|.:||.|
  Fly    19 ATGQNEGGAPGIFNGMSFTENLQPDPNQVCGMSNPN---GLVANVK----VPKDYSTPGQFPWVV 76

  Fly  1465 LVRESTWLGLFTKNKC--GGVLITSRYVITAAHCQPGFL-ASLVAVMGEFDISGDLESKRSVTKN 1526
                    .||::.|.  .|.||....|:|||....|.. |.:|...||::.....|...|..:.
  Fly    77 --------ALFSQGKYFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEFLPSEDRP 133

  Fly  1527 VKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPICMPNDVADFTGRMATVTGWGRLKYGG-G 1590
            |.||:.||::......|::|||.|.:|.:..:||..||:|:....|..:...|||||::.:.. .
  Fly   134 VARVVQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSFDQKRCLVTGWGKVAFNDEN 198

  Fly  1591 VPSVLQEVQVPIIENSVCQEMFHTA--GHNKKILTSFLCAGYANGQKDS--CEGDSGGPLV--LQ 1649
            ..::.:::::|:|..:.||:.....  |.:..:..|.:|||   |:||:  |.||.|..|.  ::
  Fly   199 YSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAG---GEKDAGDCLGDGGSALFCPME 260

  Fly  1650 RPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWL 1686
            ....|||.||.|:.||.|....:|.||.....::.|:
  Fly   261 ADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 76/248 (31%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 75/242 (31%)
Tryp_SPc 67..297 CDD:214473 74/240 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457718
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.