DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and CG8738

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:248 Identity:78/248 - (31%)
Similarity:120/248 - (48%) Gaps:27/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1455 STFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAH-----CQPGFLASLVAVMGEFDIS 1514
            |.|..:||.|.:.:..  |.|.   |||.||..:.|:|:||     .:.    ||:...|::|::
  Fly   208 SVFAEFPWMVALMDME--GNFV---CGGTLIHPQLVLTSAHNVFNRSED----SLLVRAGDWDLN 263

  Fly  1515 GDLESKRSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPICM-----PNDVADFTG 1574
            ...|......:.:..:..|..::..|..||:||:.|:.|.|...||.|||:     |...|:...
  Fly   264 SQTELHPYQMRAISELHRHENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRS 328

  Fly  1575 RMATVTGWGRLKYGGG--VPSVLQEVQVPIIENSVCQEMF-HTA-GHNKKILTSFLCAGYANGQK 1635
            .....|||| |:|...  :.::|:.:::|.:::..||.:. ||. |....:..||.|||...| |
  Fly   329 ASCLATGWG-LRYSTSRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVKG-K 391

  Fly  1636 DSCEGDSGGPLVLQRP--DGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWL 1686
            |:|.||.|.||....|  ..||:|.|.||.||:||...:|..|....:.:.|:
  Fly   392 DTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 78/248 (31%)
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 78/248 (31%)
Tryp_SPc 207..444 CDD:214473 77/246 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.