DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and CG4793

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:306 Identity:91/306 - (29%)
Similarity:135/306 - (44%) Gaps:40/306 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1402 QGATLSSYGGANGRKIHSTSRTLPTPNLAFHSP-STECGVRPHVKSGRIVGGKGSTF-------- 1457
            :|....:.|..:|:.....:..|..|..|.:.| .||||   ||  .||  |.|.|.        
  Fly    49 RGLNNGNQGCESGQTCCPKTEILQYPVQADNQPLPTECG---HV--NRI--GVGFTITNARDIAQ 106

  Fly  1458 -GAYPWQVLVRESTW---LGLFTKNKCGGVLITSRYVITAA----HCQPGFLASLVAVMGEFDIS 1514
             |..||.|.:.:|..   ||       ||.|||...|:|::    .....:   |:...||:|..
  Fly   107 KGELPWMVALLDSRSRLPLG-------GGSLITRDVVLTSSTKTLEVPEKY---LIVRAGEWDFE 161

  Fly  1515 GDLESKRSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPICMPNDVADFTGRMATV 1579
            ...|.:......:::::.|.........|:.|||.|..|::.|.||..||:|....:|......|
  Fly   162 SITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIHNRCIV 226

  Fly  1580 TGWG-RLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNKKIL-TSFLCAGYANGQKDSCEGDS 1642
            :||| :........::|:::::|:::.||||...........|| .|.:|||...| ||:|:||.
  Fly   227 SGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPG-KDTCKGDG 290

  Fly  1643 GGPLV--LQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWL 1686
            |.||.  ||....||||.|.|:.|..|..| ||..|...:..:.|:
  Fly   291 GAPLACPLQSDPNRYELLGIVNFGFGCGGP-LPAAYTDVSQIRSWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 77/258 (30%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 73/243 (30%)
Tryp_SPc 105..335 CDD:214473 72/241 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457722
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.