DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and CG4259

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:206 Identity:58/206 - (28%)
Similarity:90/206 - (43%) Gaps:34/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1456 TFGA-----YPWQVLVRES-TWL----GLFTKNKCGGVLITSRYVITAAHCQPGFLA-SLVAVMG 1509
            |:|:     :||.|.|.:. .||    |:       |.||....|:||||...|... .||...|
  Fly    30 TYGSNPRATFPWVVSVLDQRDWLFRYIGV-------GSLINPNVVLTAAHILNGTTKYDLVVRAG 87

  Fly  1510 EFDISGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHI--VPICMPNDVADF 1572
            |:|.|...: ::.|...|..::.|.|::....||::|||.|.|..:...:|  :|:.:..  |..
  Fly    88 EWDTSTTAD-QQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQE--AGI 149

  Fly  1573 TGRMATVTGWGRLKYGG-GVPSVLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAGYANGQKD 1636
            ........|||::.... ..|:||:.|||.::...:|.        ::|:....:|.....|  .
  Fly   150 QKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCS--------SRKLPIQQICGKGLEG--I 204

  Fly  1637 SCEGDSGGPLV 1647
            .|.||.|.|||
  Fly   205 DCSGDGGAPLV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 58/206 (28%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 56/197 (28%)
Tryp_SPc 39..256 CDD:214473 56/197 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457706
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.