DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and CG1304

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:265 Identity:84/265 - (31%)
Similarity:121/265 - (45%) Gaps:42/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1442 PHVKSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHC---QPGFLAS 1503
            |...:||:|||:.:....:|.||.:|.:      ..:.|||.:::..||:|||||   |.....|
  Fly    25 PGSLNGRVVGGEDAVKNQFPHQVSLRNA------GSHSCGGSILSRNYVLTAAHCVTNQDSNGNS 83

  Fly  1504 LVAVMGEFDISGDLESKRS--VTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPICMP 1566
            :......|.|......:.|  |...|..||||.:|  ..|.||:|||.|:||:.....|.||.:|
  Fly    84 VPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEY--GNFLNDVALLRLESPLILSASIQPIDLP 146

  Fly  1567 NDVADFTGRM-ATVTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAGY 1630
              .||....: ..::||||:|:.|.:|..||...:..|....|.|:....      :.|.||..:
  Fly   147 --TADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDELIGWG------VQSELCLIH 203

  Fly  1631 A--NGQKDSCEGDSGGPLVLQRPDGRYE-----LAGTVSHGIKCAAPYLPGVYMRTTFYKPWLRS 1688
            .  ||   :|.||||||.|       |.     :||.|...  |...| |..|.|..::..|:::
  Fly   204 EADNG---ACNGDSGGPAV-------YNNQVVGVAGFVWSA--CGTSY-PDGYARVYYHNEWIKN 255

  Fly  1689 ITGVK 1693
            .:.||
  Fly   256 NSDVK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 79/252 (31%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 79/250 (32%)
Tryp_SPc 32..256 CDD:238113 79/252 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457796
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.