DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and CG4653

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:269 Identity:62/269 - (23%)
Similarity:102/269 - (37%) Gaps:69/269 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1444 VKSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHCQPGFLASLVAVM 1508
            |:|.|:    .:..|:.|..:.:|.:   |:   :.|||.||..::::|||||            
  Fly    24 VQSSRL----PAEVGSQPHSISLRRN---GV---HVCGGALIREKWILTAAHC------------ 66

  Fly  1509 GEFDISGDLESKRSVTKNVK----------------RVIVHRQY--DPATFENDLALLELDSPVQ 1555
              ..:.|..:|..:.:.||:                ::|:|..|  ..|...||||||||::.|.
  Fly    67 --VSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVV 129

  Fly  1556 FDTHIVPICMPNDVADFTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNKK 1620
            .:.:..||.:..: ....|.....:|||..:..|.:..|||......:..|.||...:....:  
  Fly   130 LNANTNPIDLATE-RPAAGSQIIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQQED-- 191

  Fly  1621 ILTSFLC--------AGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYM 1677
                .||        ||.       |.||:|.|.....     :|.|..:..:.......|..|:
  Fly   192 ----LLCLSPVDEDFAGL-------CSGDAGAPASYNN-----QLVGIAAFFVSGCGSEQPDGYV 240

  Fly  1678 RTTFYKPWL 1686
            ..|.:..|:
  Fly   241 DVTQHLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 59/264 (22%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 59/259 (23%)
Tryp_SPc 30..249 CDD:214473 58/257 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457794
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.