DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and CG31827

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:240 Identity:68/240 - (28%)
Similarity:110/240 - (45%) Gaps:27/240 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1460 YPWQV-LVRESTWLGLFTKNKCGGVLITSRYVITAAH-CQPGFLASLVAVMGEFDISGDLESKRS 1522
            :||.: ::...:.:|       ||.|||...|:|||| .....:..:|...||::....||....
  Fly    55 FPWTIAVIHNRSLVG-------GGSLITPDIVLTAAHRIFNKDVEDIVVSAGEWEYGSALEKYPF 112

  Fly  1523 VTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPICMPNDVADFTGRMATVTGWGRLK- 1586
            ....|.::::|:.::.....|:||||.||........|..||:|......:.....|.|||:.: 
  Fly   113 EEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLPTQKRSLSSTRCIVAGWGKYQF 177

  Fly  1587 ----YGGGVPSVLQEVQVPIIENSVCQEMFHTA--GHNKKILTSFLCAGYANGQK--DSCEGDSG 1643
                |||    ||:::.:||:...:||:.....  |.|..:....:|||   |:|  |:|.||.|
  Fly   178 SDTHYGG----VLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAG---GEKDNDACTGDGG 235

  Fly  1644 GPLV--LQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWL 1686
            |.|.  :.....::|..|.|:.|:.|....:|..|.....:|||:
  Fly   236 GALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 68/240 (28%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 68/240 (28%)
Tryp_SPc 50..280 CDD:214473 67/238 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457712
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.