DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and Tmprss6

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:XP_006242057.1 Gene:Tmprss6 / 315388 RGDID:1307138 Length:811 Species:Rattus norvegicus


Alignment Length:261 Identity:97/261 - (37%)
Similarity:142/261 - (54%) Gaps:26/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1437 ECGVRPHVKSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHC-QPGF 1500
            :||::.  .|.|||||..|:.|.:|||..      |.:..::.|||.||..|:||||||| |...
  Rat   567 DCGLQG--PSSRIVGGAMSSEGEWPWQAS------LQIRGRHICGGALIADRWVITAAHCFQEDS 623

  Fly  1501 LAS---LVAVMGEFDISGDLESKR---SVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTH 1559
            :||   ....:|:.     .::.|   .|:..|.|:.:|..::..:.:.|:|||:||.||.:...
  Rat   624 MASPRLWTVFLGKM-----RQNSRWPGEVSFKVSRLFLHPYHEEDSHDYDVALLQLDHPVVYSAT 683

  Fly  1560 IVPICMPNDVADF-TGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNKKILT 1623
            :.|:|:|.....| .|:...:||||..:.||...|.||:|.|.:|...:|.|     .:..::..
  Rat   684 VRPVCLPARSHFFEPGQHCWITGWGAQREGGPGSSTLQKVDVQLIPQDLCNE-----AYRYQVTP 743

  Fly  1624 SFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWLRS 1688
            ..|||||..|:||:|:||||||||.:.|.||:.|||.||.|:.|..|...|||.|.|....|::.
  Rat   744 RMLCAGYRKGKKDACQGDSGGPLVCKEPSGRWFLAGLVSWGLGCGRPNFFGVYTRVTRVVNWIQQ 808

  Fly  1689 I 1689
            :
  Rat   809 V 809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 93/247 (38%)
Tmprss6XP_006242057.1 SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486
Tryp_SPc 576..806 CDD:214473 93/245 (38%)
Tryp_SPc 577..809 CDD:238113 93/247 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.