DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and CG6048

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster


Alignment Length:270 Identity:97/270 - (35%)
Similarity:138/270 - (51%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1440 VRPHVKS--GRIVGGKGSTFGAYPWQVLVRESTWLGLF--TKNKCGGVLITSRYVITAAHCQPGF 1500
            :||...:  |||:.|..::.||...||.:|::...|.|  |.:.|||.||...:|:|||||   |
  Fly    35 IRPRFNADPGRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHC---F 96

  Fly  1501 LASL------------VAVMGEFDISGDLESKRSVTKNV-KRVIVHRQYDPATFENDLALLELDS 1552
            :..:            :.|||..|   ......::|..: :|::...::|.:|::.|:|||.|:.
  Fly    97 VDQIIYDGTFVPKEEFIVVMGNLD---RYNRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNG 158

  Fly  1553 --PVQFDTHIVPICMPNDVADFTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVC---QEMF 1612
              |....| |.||.: |..|...|.:..|||||..: .|.|..:|..|.||:|....|   .::.
  Fly   159 TVPTGHPT-IRPIAL-NRFAIPEGVVCQVTGWGNTE-DGYVSDILMTVDVPMISEEHCINDSDLG 220

  Fly  1613 HTAGHNKKILTSFLCAGYAN-GQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVY 1676
            |.      |....:||||.. |:||:|.||||||||.|.     ||||.||.||:||.|.|||||
  Fly   221 HL------IQPGMICAGYLEVGEKDACAGDSGGPLVCQS-----ELAGVVSWGIQCALPRLPGVY 274

  Fly  1677 MRTTFYKPWL 1686
            ...::|..|:
  Fly   275 TEVSYYYDWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 93/259 (36%)
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 93/258 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.