DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and F12

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_001014028.1 Gene:F12 / 306761 RGDID:1359175 Length:603 Species:Rattus norvegicus


Alignment Length:323 Identity:97/323 - (30%)
Similarity:142/323 - (43%) Gaps:39/323 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1383 VDEEDEEDVNPNPSDNEIDQGATLSSYGGANGRKIHSTSRTLPTPNLAFHSPSTECGVRPHVKSG 1447
            |..|..:.:.|.|...::.|..:||.....:.|..:..|||          .:..||.|...:..
  Rat   303 VSPESHDMLKPRPPILQMPQFPSLSDALDNSTRNQNVVSRT----------STVVCGQRFRKRLS 357

  Fly  1448 ---RIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHC---QPGFLASLVA 1506
               |:|||..:..|::|:   :....|...|    |.|.||...:|:|||||   :|. ...|..
  Rat   358 SLRRVVGGLVALPGSHPY---IAALYWGDSF----CAGSLIDPCWVLTAAHCLQKRPA-PEELTV 414

  Fly  1507 VMGEFDISGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLEL----DSPVQFDTHIVPICMPN 1567
            |:|:...:...|  |..|..|....:|..:...|:::|||||.|    :|......|:.|:|:|:
  Rat   415 VLGQDRHNQSCE--RCQTLAVHSYRLHEGFSSKTYQHDLALLRLRGRKNSCAILSPHVQPVCLPS 477

  Fly  1568 DVADFTGR-MATVTGWGRLKYGGG--VPSVLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAG 1629
            ..|..:.. :..|.|||. ::.|.  ..:.|||.|||.|....|..   :..|...||...||||
  Rat   478 SAAPPSETVLCEVAGWGH-QFEGAEEYATFLQEAQVPFISLDRCSS---SNVHGDAILPGMLCAG 538

  Fly  1630 YANGQKDSCEGDSGGPLVLQR--PDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWLRSIT 1690
            :..|..|:|:||||||||...  .:.:..|.|.:|.|..|.....||||.....|..|::..|
  Rat   539 FLEGGADACQGDSGGPLVCDEGVTERQLTLRGVISWGSGCGDRNKPGVYTDVANYLDWIQEHT 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 81/251 (32%)
F12NP_001014028.1 FN2 40..87 CDD:238019
EGF_CA 95..130 CDD:238011
FN1 132..170 CDD:238018
EGF 177..207 CDD:278437
Kringle 216..294 CDD:278480
Tryp_SPc 361..597 CDD:214473 81/249 (33%)
Tryp_SPc 362..600 CDD:238113 81/251 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.