DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and HABP2

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_004123.1 Gene:HABP2 / 3026 HGNCID:4798 Length:560 Species:Homo sapiens


Alignment Length:293 Identity:98/293 - (33%)
Similarity:149/293 - (50%) Gaps:52/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1421 SRTLPTPNL-AFHS-PSTECGVRPHVKSGRIVGGKGSTFGAYPWQVLVRESTWL------GLFTK 1477
            |.|.|:..| .|.| ..||...|   |..||.||..||.|.:|||..::.|..|      |.|  
Human   287 SPTEPSTKLPGFDSCGKTEIAER---KIKRIYGGFKSTAGKHPWQASLQSSLPLTISMPQGHF-- 346

  Fly  1478 NKCGGVLITSRYVITAAHCQPGFLASLVAVMGEFDISGDLESKRSVTKNVKRVIVHRQYD----- 1537
              |||.||...:|:|||||.......|..|:|:.|:..:...::|.  .|:::..:..|:     
Human   347 --CGGALIHPCWVLTAAHCTDIKTRHLKVVLGDQDLKKEEFHEQSF--RVEKIFKYSHYNERDEI 407

  Fly  1538 PATFENDLALLELDSPVQFDTH-------IVPICMPNDVADFTGRMATVTGWGRLKYGGGVPSVL 1595
            |   .||:|||:| .||  |.|       :..:|:| |.:..:|....::|||..:.|.|...:|
Human   408 P---HNDIALLKL-KPV--DGHCALESKYVKTVCLP-DGSFPSGSECHISGWGVTETGKGSRQLL 465

  Fly  1596 QEVQVPIIENSVC--QEMFHTAGHNKKILTSFLCAGYANGQK---DSCEGDSGGPLVLQRPDGRY 1655
             :.:|.:|.|::|  ::::     :..|..|.:|||  |.||   |:|:|||||||..:: ||.|
Human   466 -DAKVKLIANTLCNSRQLY-----DHMIDDSMICAG--NLQKPGQDTCQGDSGGPLTCEK-DGTY 521

  Fly  1656 ELAGTVSHGIKCAAPYLPGVYMRTTFYKPWLRS 1688
            .:.|.||.|::|..  .||||.:.|.:..|:::
Human   522 YVYGIVSWGLECGK--RPGVYTQVTKFLNWIKA 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 87/263 (33%)
HABP2NP_004123.1 EGF 77..106 CDD:306513
KR 191..277 CDD:238056
Tryp_SPc 314..553 CDD:238113 87/263 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.