DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and F10

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_058839.1 Gene:F10 / 29243 RGDID:61850 Length:482 Species:Rattus norvegicus


Alignment Length:359 Identity:102/359 - (28%)
Similarity:154/359 - (42%) Gaps:85/359 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1349 TTTRRPATKKPTRRVSSTVKTTTVSSARPADDEIVDEEDEEDVNPNPSDNEIDQGATLSSYGGAN 1413
            :|...|..|....|...:|...|.:|          |.|.||:.|   |.:|             
  Rat   166 STAPFPCGKTNKGRAKRSVALNTSNS----------EPDPEDLMP---DADI------------- 204

  Fly  1414 GRKIHSTSRTLPTPNLAFHSPSTECGVRPHVKSG---RIVGGKGSTFGAYPWQVLVRESTWLGLF 1475
               ::.|.    :|:...:...||    |...|.   |||||:....|..|||.|        ||
  Rat   205 ---LYPTE----SPSELLNLNKTE----PEANSDDVIRIVGGQECKRGECPWQAL--------LF 250

  Fly  1476 ----TKNKCGGVLITSRYVITAAHCQPGFLASLVAVMGEFDISGDLESKR----SVTKNVKRVIV 1532
                |...|||.::...|::|||||........|.|       |||.:::    .:...|..:|.
  Rat   251 SDEETDGFCGGTILNEFYILTAAHCLHQAKRFKVRV-------GDLNTEQEDGGEMVHEVDMIIK 308

  Fly  1533 HRQYDPATFENDLALLELDSPVQFDTHIVPICMP-NDVAD---FTGRMATVTGWGRLKYGGGVPS 1593
            |.::...|::.|:|:|.|.:|:.|..::.|.|:| .|.|:   .|.:...|:|:||....|....
  Rat   309 HNKFQRDTYDFDIAMLRLKTPITFRENVAPACLPQKDWAEATLMTQKTGIVSGFGRTHEKGRQSK 373

  Fly  1594 VLQEVQVPIIENSVCQEMFHTAGHNKKILTSF------LCAGYANGQKDSCEGDSGGPLVLQRPD 1652
            ||:.::||.::.:.|           ::.|||      .||||...|:|:|:||||||.|.:..|
  Rat   374 VLKMMEVPYVDRNTC-----------RLSTSFSITQNMFCAGYDAKQEDACQGDSGGPHVTRFKD 427

  Fly  1653 GRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWL 1686
             .|.:.|.||.|..||.....|:|.:.|.:..|:
  Rat   428 -TYFVTGIVSWGEGCARKGKYGIYTKVTAFLKWI 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 81/256 (32%)
F10NP_058839.1 GLA 23..84 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:405372
Tryp_SPc 232..462 CDD:238113 81/256 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.