DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and PRSS50

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_037402.1 Gene:PRSS50 / 29122 HGNCID:17910 Length:385 Species:Homo sapiens


Alignment Length:384 Identity:91/384 - (23%)
Similarity:147/384 - (38%) Gaps:107/384 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1332 TTRKPATRRTTVAAKVTTTTRRPAT--KKPTRRVSSTVKTTTVSSARPADDEIVDEEDEEDVNPN 1394
            :|..||.:......|.|..:.||..  :.||   :.|:.:||:.:..|..:..||          
Human    48 STADPADQSVQCVPKATCPSSRPRLLWQTPT---TQTLPSTTMETQFPVSEGKVD---------- 99

  Fly  1395 PSDNEIDQGATLSSYGGANGRKIHSTSRTLPTPNLAFHSPSTECGVR----PHVKSGRIVGGKGS 1455
                                                   |...||..    |.::....|..:  
Human   100 ---------------------------------------PYRSCGFSYEQDPTLRDPEAVARR-- 123

  Fly  1456 TFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHCQPGFLASLV--AVMGEFDISGDLE 1518
                :||.|.||.:      ..:.|.|.:|.|::|:|.|||       |:  .|:....:.....
Human   124 ----WPWMVSVRAN------GTHICAGTIIASQWVLTVAHC-------LIWRDVIYSVRVGSPWI 171

  Fly  1519 SKRSVTKN---VKRVIVHRQYDPATF------ENDLALLELDSPVQFDTHIVPICMPNDVADFTG 1574
            .:.:.|.:   |.:||:|.:|....|      .||:.||:|...:::..::.|||:|.  .|:..
Human   172 DQMTQTASDVPVLQVIMHSRYRAQRFWSWVGQANDIGLLKLKQELKYSNYVRPICLPG--TDYVL 234

  Fly  1575 R---MATVTGWGRLKYGGGVPS--VLQEVQVPIIENSVCQEMFHTAGHNKKILT-------SFLC 1627
            :   ..||||||..|..|..|.  .:||.:|.|:.|..|...:|   :..||.|       ..:|
Human   235 KDHSRCTVTGWGLSKADGMWPQFRTIQEKEVIILNNKECDNFYH---NFTKIPTLVQIIKSQMMC 296

  Fly  1628 AGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWL 1686
            |...:.:| .|...:|.|||... :|.:.|.|.||.|..|.....|.:|::.:.|:.|:
Human   297 AEDTHREK-FCYELTGEPLVCSM-EGTWYLVGLVSWGAGCQKSEAPPIYLQVSSYQHWI 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 72/261 (28%)
PRSS50NP_037402.1 Tryp_SPc 118..353 CDD:238113 71/260 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.