DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and Prss29

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:266 Identity:92/266 - (34%)
Similarity:139/266 - (52%) Gaps:46/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1449 IVGGKGSTFGAYPWQVLVRE-----STWLGLFTKNKCGGVLITSRYVITAAHC------QPG--- 1499
            ||||..:..|.:||||.:|.     ::|:.:     |||.:|..::|:|||||      .|.   
  Rat    31 IVGGNSAPQGKWPWQVSLRVYRYNWASWVHI-----CGGSIIHPQWVLTAAHCIHESDADPSAFR 90

  Fly  1500 -FLASLVAVMGEFDISGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPI 1563
             :|..:....||           .:.| |.|||:|..:..:...:|:|||:|...|:...::.|:
  Rat    91 IYLGQVYLYGGE-----------KLLK-VSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPNVKPV 143

  Fly  1564 CMPNDVADFTGR-MATVTGWGRLKYGGGVPSV--LQEVQVPIIENSVCQEMFHTA----GHNKK- 1620
            .:.....:.|.: :..|||||.:.....:|..  ||:|||.|::|::|::::..|    .|.:: 
  Rat   144 KLSPASLEVTKKDVCWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTLCEKLYRNATRLSNHGQRL 208

  Fly  1621 ILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPW 1685
            ||...|||| ::| :|||.||||||||. ...|.:.|.|.||.|..||...:||||.|..|:.||
  Rat   209 ILQDMLCAG-SHG-RDSCYGDSGGPLVC-NVTGSWTLVGVVSWGYGCALKDIPGVYARVQFFLPW 270

  Fly  1686 LRSITG 1691
               |||
  Rat   271 ---ITG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 89/262 (34%)
Prss29XP_017453326.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346511
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.