DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and Tpsg1

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:342 Identity:110/342 - (32%)
Similarity:164/342 - (47%) Gaps:52/342 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1362 RVSSTVKTTTVSSARPADDEIVDEEDEEDVN-----PNPSDNEIDQGATLSSYGGANGRKIHSTS 1421
            |:||    ..:|||:|:..  |.:::...::     ..|...|..|.||......|.|:...|.:
Mouse     8 RISS----EKLSSAQPSHQ--VTDKNGHWIHLCHGLQGPGLAESFQWATSKPTVSARGQYPDSLA 66

  Fly  1422 RTLPTPNLAFHSPSTECGVRPHVKS--GRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVL 1484
            .::        |..:.|| .|.|.:  .|||||..:..|.:|||..:|      |...:.|||.|
Mouse    67 NSV--------SSGSGCG-HPQVSNSGSRIVGGHAAPAGTWPWQASLR------LHKVHVCGGSL 116

  Fly  1485 ITSRYVITAAHCQPGFLASLVAVMGEFDIS-GDLESKRSVT-----KNVKRVIVHR-QYDPATFE 1542
            ::..:|:|||||..|.:.|     .::.:. |:|    :||     ..|||:|::. ...|....
Mouse   117 LSPEWVLTAAHCFSGSVNS-----SDYQVHLGEL----TVTLSPHFSTVKRIIMYTGSPGPPGSS 172

  Fly  1543 NDLALLELDSPVQFDTHIVPICMPNDVADF-TGRMATVTGWGRLKYGGGV--PSVLQEVQVPIIE 1604
            .|:||::|.|||...:.:.|:|:|...||| .|....|||||....|..:  |..|||.:|.:::
Mouse   173 GDIALVQLSSPVALSSQVQPVCLPEASADFYPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVD 237

  Fly  1605 NSVCQEMFHTAGHNKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAA 1669
            ...|.:.:::. :...|....||   |.|..|:|:.|||||||.| ..|.::.||.||.|..|..
Mouse   238 VKTCSQAYNSP-NGSLIQPDMLC---ARGPGDACQDDSGGPLVCQ-VAGTWQQAGVVSWGEGCGR 297

  Fly  1670 PYLPGVYMRTTFYKPWL 1686
            |..||||.|.|.|..|:
Mouse   298 PDRPGVYARVTAYVNWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 88/248 (35%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 88/248 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842948
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.