DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and F7

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_690059.1 Gene:F7 / 260320 RGDID:628678 Length:446 Species:Rattus norvegicus


Alignment Length:400 Identity:118/400 - (29%)
Similarity:174/400 - (43%) Gaps:85/400 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1361 RRVSSTVKTTTVSS-ARPADDEIVDEEDEEDVNPNP----------------SDNEIDQGAT--- 1405
            ||.:|.::....|| .|..::|....|:..::..:|                :.|....|.|   
  Rat    40 RRANSLLEELWSSSLERECNEERCSFEEAREIFKSPERTKQFWTIYSDGDQCASNPCQNGGTCQD 104

  Fly  1406 -LSSY-----------------------GGANG------RKIHSTSRT-------LPTPNLAFHS 1433
             |.||                       ...||      |....|.||       :..|:.....
  Rat   105 HLKSYVCFCPLDFEGRNCEKNKNEQLICANENGDCDQYCRDHVGTKRTCSCHEDYVLQPDEVSCK 169

  Fly  1434 PSTE--CGVRPHVK-------SGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRY 1489
            |..|  ||..|.|:       .||||||.....|..|||.:::.:..|      .||.||:.:|:
  Rat   170 PKVEYPCGRIPVVEKRNFSRPQGRIVGGYVCPKGECPWQAVLKFNEAL------LCGAVLLDTRW 228

  Fly  1490 VITAAHC--QPGFLASLVAVMGEFDISGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLELDS 1552
            ::|||||  :.|.|.::..|:||.|.| :.|....| :.|::||:..:|.....::|:||:.|..
  Rat   229 IVTAAHCFDKFGKLVNITVVLGEHDFS-EKEGTEQV-RLVEQVIMPNKYTRGRTDHDIALVRLHR 291

  Fly  1553 PVQFDTHIVPICMP------NDVADFTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEM 1611
            ||.|..::||:|:|      |.:|..  |.:.|:|||:|...|.....|..::||.:....|.|.
  Rat   292 PVTFTDYVVPLCLPERAFSENTLASI--RFSRVSGWGQLLDRGATALELMVIEVPRLMTQDCLEH 354

  Fly  1612 FHTAGHNKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVY 1676
            ...:.:..:|..:..||||.:|.||:|:||||||..... .|.:.|.|.||.|..|||....|||
  Rat   355 AKHSANTPRITENMFCAGYMDGTKDACKGDSGGPHATHY-HGTWYLTGVVSWGEGCAAIGHIGVY 418

  Fly  1677 MRTTFYKPWL 1686
            .|.:.|..||
  Rat   419 TRVSQYIDWL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 87/245 (36%)
F7NP_690059.1 GLA 25..85 CDD:214503 9/44 (20%)
EGF_CA 87..123 CDD:238011 6/35 (17%)
Tryp_SPc 194..430 CDD:238113 87/245 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.