DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and mst1

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_694512.1 Gene:mst1 / 259260 ZFINID:ZDB-GENE-020806-3 Length:709 Species:Danio rerio


Alignment Length:277 Identity:83/277 - (29%)
Similarity:129/277 - (46%) Gaps:43/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1425 PTPNLAFHSPSTECGVR-PHVKSG-RIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITS 1487
            ||..:.|:    |||.| ..::|. |||||   |.|..||.|.:|:..     ..:.|||.|::|
Zfish   460 PTTEVEFN----ECGKREDRLRSRLRIVGG---TPGNSPWTVSLRDRK-----GNHFCGGSLVSS 512

  Fly  1488 RYVITAAHCQPGF---LASLVAVMGEF---DISGDLESKR-SVTKNVKRVIVHRQYDPATFENDL 1545
            .:||:...|....   |....|:||..   ...|:.:.:| |:||.|        ..|:  |:.|
Zfish   513 EWVISTKQCFSSCYVDLTGYTAMMGTLFRDPKEGEPDLQRISLTKIV--------CGPS--ESHL 567

  Fly  1546 ALLELDSPVQFDTHIVPICMPND---VADFTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSV 1607
            .:|:|::|.||:..:..||:|.:   |.|  |.:..:.|||..| |.|..:||...|:|::.|..
Zfish   568 VMLQLETPAQFNERVSQICLPPERYIVPD--GTICEIAGWGETK-GKGDETVLNVAQMPVLSNKD 629

  Fly  1608 CQEMFHTAGHNKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYL 1672
            |.:.|.......::.|....||..     :||.|.||||..|..| .:.|.|.:....:|.....
Zfish   630 CNQYFKGRVRENEMCTMAFQAGVG-----ACERDYGGPLACQNSD-CWVLEGVIIPMRRCGHAGQ 688

  Fly  1673 PGVYMRTTFYKPWLRSI 1689
            |.:::|.:.|..|::.:
Zfish   689 PNIFIRVSVYVDWIKKV 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 74/249 (30%)
mst1NP_694512.1 PAN_AP_HGF 24..105 CDD:238532
KR 109..187 CDD:238056
KR 192..271 CDD:214527
KR 284..365 CDD:214527
KR 370..451 CDD:238056
Tryp_SPc 481..702 CDD:214473 74/247 (30%)
Tryp_SPc 482..705 CDD:238113 74/249 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.