DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and TPSG1

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:260 Identity:100/260 - (38%)
Similarity:137/260 - (52%) Gaps:29/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1438 CGVRPHVK--SGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHCQPGF 1500
            || ||.|.  .||||||..:..||:|||..:|      |...:.|||.|::.::|:|||||..|.
Human    51 CG-RPQVSDAGGRIVGGHAAPAGAWPWQASLR------LRRVHVCGGSLLSPQWVLTAAHCFSGS 108

  Fly  1501 LASLVAVMGEFDIS-GDLESKRSV-TKNVKRVIVHR--QYDPATFENDLALLELDSPVQFDTHIV 1561
            |.|     .::.:. |:||...|. ...|:::|:|.  ...|.| ..|:||:||..||...:.|:
Human   109 LNS-----SDYQVHLGELEITLSPHFSTVRQIILHSSPSGQPGT-SGDIALVELSVPVTLSSRIL 167

  Fly  1562 PICMPNDVADF-TGRMATVTGWGRLKYGGGVPS--VLQEVQVPIIENSVCQEMFHTAGHNKKIL- 1622
            |:|:|....|| .|....|||||..:.|..:|.  .|:||:|.:::...|:..:  .|....|| 
Human   168 PVCLPEASDDFCPGIRCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDY--PGPGGSILQ 230

  Fly  1623 TSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWLR 1687
            ...||   |.|..|:|:.|||||||.| .:|.:..|||||.|..|..|..||||.|...|..|:|
Human   231 PDMLC---ARGPGDACQDDSGGPLVCQ-VNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIR 291

  Fly  1688  1687
            Human   292  291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 93/247 (38%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 92/245 (38%)
Tryp_SPc 63..293 CDD:238113 93/247 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152876
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.