DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and CG30091

DIOPT Version :10

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:191 Identity:42/191 - (21%)
Similarity:66/191 - (34%) Gaps:46/191 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 LGLAANQLERLD--MSMFAFMPELEQFDVRGNRIVRFEATAPV-----------TYGSLTRL--- 214
            ||:.|..|..||  ...:..:|...::...|| :|.|....||           |||.:.:|   
  Fly     8 LGVIATLLAALDWKYKSYEHLPGPRRWPFIGN-VVSFLGAGPVEIFDQLIAFASTYGKVYKLDFF 71

  Fly   215 ----LVSSNNITQFDTRNLTLSELRSLYLDDNALTELPTHWGKLPKLIYLGFDRNYLKRVDMSFF 275
                ::.|:            .|.....|...|.|.....:.|:.:.|..|.    |...|..:|
  Fly    72 YDYTIIYSS------------PEAAEAILTSPAFTAKSQDYDKVSEWIGNGL----LISRDQKWF 120

  Fly   276 GKFPTLTAIF---ISENIVETIRTSTPITMPELDIILFESNQIVSVNFTGCNFPKMNLVSL 333
            .....:|..|   |.||.|............:|:.:...|...|:|      ||::.|::|
  Fly   121 THRKVITPGFHFKILENFVPVFNRQAEAFCAKLETLTGRSADAVNV------FPELKLLTL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 35/163 (21%)
Tryp_SPc 332..520 CDD:473915
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.