DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and Mst1

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:XP_038936729.1 Gene:Mst1 / 24566 RGDID:3114 Length:747 Species:Rattus norvegicus


Alignment Length:262 Identity:71/262 - (27%)
Similarity:113/262 - (43%) Gaps:34/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1437 ECGVRPHVKSG-RIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHC---- 1496
            :||.|....:. |:|||..   |..||.|.:|...     .::.|||.|:..::|:||..|    
  Rat   507 KCGKRVDQSNRLRVVGGHP---GNSPWTVSLRNRQ-----GQHFCGGSLVKEQWVLTARQCIWSC 563

  Fly  1497 -QPGFLASLVAVMGEFDISGDLESKRSVTKNVKRVIVHRQY-DPATFENDLALLELDSPVQFDTH 1559
             .|  |......:|..:     ::.:....|::||.|.:.. .||  .:.|.||:|:.||..:.|
  Rat   564 HDP--LTGYEVWLGTIN-----QNPQPGEANLQRVSVAKTVCGPA--GSQLVLLKLERPVILNHH 619

  Fly  1560 IVPICMPND--VADFTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNKKIL 1622
            :..||:|.:  |.. .|....:.|||..| |....:||...::.:|.:..|...:.......:|.
  Rat   620 VARICLPPEQYVVP-PGTNCEIAGWGESK-GTSNSTVLHVAKMKVISSQECNVKYRRRVQESEIC 682

  Fly  1623 TSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWLR 1687
            |..|.|     ...:||||.||||.....| .:.|.|.:.....||.|..|.::.|.:.:..|:.
  Rat   683 TEGLLA-----PTGACEGDYGGPLACYTHD-CWVLQGLIIPNRVCARPRWPAIFTRVSVFVDWIN 741

  Fly  1688 SI 1689
            .:
  Rat   742 KV 743

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 67/247 (27%)
Mst1XP_038936729.1 PAN_1 32..111 CDD:394981
KR 116..196 CDD:214527
KR 199..276 CDD:214527
KR 321..403 CDD:214527
KR 408..490 CDD:214527
Tryp_SPc 520..743 CDD:238113 67/247 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.