DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and Habp2

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_001316864.1 Gene:Habp2 / 226243 MGIID:1196378 Length:554 Species:Mus musculus


Alignment Length:294 Identity:102/294 - (34%)
Similarity:150/294 - (51%) Gaps:53/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1425 PTPNLAFHSPSTE------CG---VRPH-VKSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTK-- 1477
            |.|..:...|..|      ||   |..| ||  ||.||..||.|.:||||.::.|  |.|.|.  
Mouse   276 PNPVESLLEPVMELPGFESCGKTEVAEHAVK--RIYGGFKSTAGKHPWQVSLQTS--LPLTTSMP 336

  Fly  1478 --NKCGGVLITSRYVITAAHCQPGFLASLVAVMGEFDISGDLESKRSVTKNVKRVIVHRQYD--- 1537
              :.|||.||...:|:|||||.......|..|:|:.|:. ..||... |..|::::.:.||:   
Mouse   337 QGHFCGGALIHPCWVLTAAHCTDINTKHLKVVLGDQDLK-KTESHEQ-TFRVEKILKYSQYNERD 399

  Fly  1538 --PATFENDLALLELDSPV-----QFDTHIVPICMPNDVADFTGRMATVTGWGRLKYGGGVPSVL 1595
              |   .||:|||:| .||     ....::..:|:|:|... :|....::|||..:.|.|...:|
Mouse   400 EIP---HNDIALLKL-KPVGGHCALESRYVKTVCLPSDPFP-SGTECHISGWGVTETGEGSRQLL 459

  Fly  1596 QEVQVPIIENSVC--QEMF-HTAGHNKKILTSFLCAGYANGQK---DSCEGDSGGPLVLQRPDGR 1654
             :.:|.:|.|.:|  :::: ||      |..|.:|||  |.||   |:|:|||||||..:: ||.
Mouse   460 -DAKVKLIANPLCNSRQLYDHT------IDDSMICAG--NLQKPGSDTCQGDSGGPLTCEK-DGT 514

  Fly  1655 YELAGTVSHGIKCAAPYLPGVYMRTTFYKPWLRS 1688
            |.:.|.||.|.:|...  ||||.:.|.:..|:::
Mouse   515 YYVYGIVSWGQECGKK--PGVYTQVTKFLNWIKT 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 91/260 (35%)
Habp2NP_001316864.1 EGF_CA 67..103 CDD:238011
EGF_CA 150..182 CDD:238011
KR 187..271 CDD:238056
Tryp_SPc 308..547 CDD:238113 91/260 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.