DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and F12

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_000496.2 Gene:F12 / 2161 HGNCID:3530 Length:615 Species:Homo sapiens


Alignment Length:306 Identity:97/306 - (31%)
Similarity:139/306 - (45%) Gaps:47/306 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1416 KIHSTSRTLP--------------TPNLAFHSPSTECG--VRPHVKS-GRIVGGKGSTFGAYPWQ 1463
            |...|:||.|              .|:|..:.| ..||  :|..:.| .|:|||..:..||:|: 
Human   324 KPQPTTRTPPQSQTPGALPAKREQPPSLTRNGP-LSCGQRLRKSLSSMTRVVGGLVALRGAHPY- 386

  Fly  1464 VLVRESTWLGLFTKNKCGGVLITSRYVITAAHCQPGFLA--SLVAVMGEFDISGDLESKRSVTKN 1526
              :....|...|    |.|.||...:|:|||||.....|  .|..|:|:...:...|..:::.  
Human   387 --IAALYWGHSF----CAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLA-- 443

  Fly  1527 VKRVIVHRQYDPATFENDLALLELD-----SPVQFDTHIVPICMPNDVA---DFTGRMATVTGWG 1583
            |:...:|..:.|.::::|||||.|.     |......::.|:|:|:..|   :.|  :..|.|||
Human   444 VRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSGAARPSETT--LCQVAGWG 506

  Fly  1584 RLKYGGG--VPSVLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAGYANGQKDSCEGDSGGPL 1646
            . ::.|.  ..|.|||.|||.:....|..   ...|...||...||||:..|..|:|:|||||||
Human   507 H-QFEGAEEYASFLQEAQVPFLSLERCSA---PDVHGSSILPGMLCAGFLEGGTDACQGDSGGPL 567

  Fly  1647 VL--QRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWLRSIT 1690
            |.  |..:.|..|.|.:|.|..|.....||||....:|..|:|..|
Human   568 VCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHT 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 83/253 (33%)
F12NP_000496.2 FN2 41..88 CDD:128373
EGF_CA 96..131 CDD:238011
FN1 133..173 CDD:238018
EGF 178..206 CDD:278437
Kringle 217..295 CDD:278480
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..359 8/35 (23%)
Tryp_SPc 372..609 CDD:214473 82/251 (33%)
Tryp_SPc 373..612 CDD:238113 83/253 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.