DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and F10

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:347 Identity:98/347 - (28%)
Similarity:151/347 - (43%) Gaps:69/347 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1354 PATKKPTRRVSSTVKTTTVSSARPADDEIVDEEDEEDVNP--NPSDNEIDQGATLSSYGGANGRK 1416
            |..|:...|...:|...|.||....|.......|..|::|  ||.| .:|...|....|..|   
Human   171 PCGKQTLERRKRSVAQATSSSGEAPDSITWKPYDAADLDPTENPFD-LLDFNQTQPERGDNN--- 231

  Fly  1417 IHSTSRTLPTPNLAFHSPSTECGVRPHVKSGRIVGGKGSTFGAYPWQ-VLVRESTWLGLFTKNKC 1480
                                         ..|||||:....|..||| :|:.|.      .:..|
Human   232 -----------------------------LTRIVGGQECKDGECPWQALLINEE------NEGFC 261

  Fly  1481 GGVLITSRYVITAAHCQPGFLASLVAV-MGEFDISGDLESKRSVTKNVKRVIVHRQYDPATFEND 1544
            ||.:::..|::|||||.  :.|....| :|  |.:.:.|........|:.||.|.::...|::.|
Human   262 GGTILSEFYILTAAHCL--YQAKRFKVRVG--DRNTEQEEGGEAVHEVEVVIKHNRFTKETYDFD 322

  Fly  1545 LALLELDSPVQFDTHIVPICMP-NDVAD---FTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIEN 1605
            :|:|.|.:|:.|..::.|.|:| .|.|:   .|.:...|:|:||....|...:.|:.::||.::.
Human   323 IAVLRLKTPITFRMNVAPACLPERDWAESTLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDR 387

  Fly  1606 SVCQEMFHTAGHNKKILTSFL------CAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHG 1664
            :.|           |:.:||:      ||||...|:|:|:||||||.|.:..| .|.:.|.||.|
Human   388 NSC-----------KLSSSFIITQNMFCAGYDTKQEDACQGDSGGPHVTRFKD-TYFVTGIVSWG 440

  Fly  1665 IKCAAPYLPGVYMRTTFYKPWL 1686
            ..||.....|:|.:.|.:..|:
Human   441 EGCARKGKYGIYTKVTAFLKWI 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 79/250 (32%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:317114
O-glycosylated at one site 183..203 5/19 (26%)
Tryp_SPc 235..464 CDD:238113 79/250 (32%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.