DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and F9

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens


Alignment Length:349 Identity:100/349 - (28%)
Similarity:163/349 - (46%) Gaps:74/349 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1354 PATKKPTRR--VSSTVKTTTVSSARPADDEIVDEEDEEDVNPNPSDNEIDQGATLSSYGGANGRK 1416
            ||...|..|  ||.|.|.|...:..| |.:.|:..:.|.:    .||......:.:.:       
Human   172 PAVPFPCGRVSVSQTSKLTRAETVFP-DVDYVNSTEAETI----LDNITQSTQSFNDF------- 224

  Fly  1417 IHSTSRTLPTPNLAFHSPSTECGVRPHVKSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCG 1481
                                          .|:|||:.:..|.:||||::...  :..|    ||
Human   225 ------------------------------TRVVGGEDAKPGQFPWQVVLNGK--VDAF----CG 253

  Fly  1482 GVLITSRYVITAAHC-QPGFLASLVAVMGEFDI--SGDLESKRSVTKNVKRVIVHRQYDPA--TF 1541
            |.::..::::||||| :.|...::||  ||.:|  :...|.||    ||.|:|.|..|:.|  .:
Human   254 GSIVNEKWIVTAAHCVETGVKITVVA--GEHNIEETEHTEQKR----NVIRIIPHHNYNAAINKY 312

  Fly  1542 ENDLALLELDSPVQFDTHIVPICMPNDVADFTG-----RMATVTGWGRLKYGGGVPSVLQEVQVP 1601
            .:|:||||||.|:..::::.|||:.:  .::|.     ....|:||||:.:.|....|||.::||
Human   313 NHDIALLELDEPLVLNSYVTPICIAD--KEYTNIFLKFGSGYVSGWGRVFHKGRSALVLQYLRVP 375

  Fly  1602 IIENSVCQEMFHTAGHNKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIK 1666
            :::.:.|........:|     :..|||:..|.:|||:||||||.|.: .:|...|.|.:|.|.:
Human   376 LVDRATCLRSTKFTIYN-----NMFCAGFHEGGRDSCQGDSGGPHVTE-VEGTSFLTGIISWGEE 434

  Fly  1667 CAAPYLPGVYMRTTFYKPWLRSIT 1690
            ||.....|:|.:.:.|..|::..|
Human   435 CAMKGKYGIYTKVSRYVNWIKEKT 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 83/249 (33%)
F9NP_000124.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:317114
Tryp_SPc 227..457 CDD:238113 83/249 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.