DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and St14

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:XP_036010597.1 Gene:St14 / 19143 MGIID:1338881 Length:875 Species:Mus musculus


Alignment Length:268 Identity:96/268 - (35%)
Similarity:142/268 - (52%) Gaps:27/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1437 ECGVRPHVKSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHC---QP 1498
            :||:|...|..|:|||..:..|.:||||.:.     .|...:.||..||:..::::||||   ..
Mouse   623 DCGLRSFTKQARVVGGTNADEGEWPWQVSLH-----ALGQGHLCGASLISPDWLVSAAHCFQDDK 682

  Fly  1499 GFLAS----LVAVMGEFDISGDLESKRSVT----KNVKRVIVHRQYDPATFENDLALLELDSPVQ 1555
            .|..|    ..|.:|..|     :||||.:    ..:||:|.|..::..||:.|:|||||:..|:
Mouse   683 NFKYSDYTMWTAFLGLLD-----QSKRSASGVQELKLKRIITHPSFNDFTFDYDIALLELEKSVE 742

  Fly  1556 FDTHIVPICMPNDVADF-TGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNK 1619
            :.|.:.|||:|:....| .|:...|||||..|.||....:||:.::.:|..:.|:::.     .:
Mouse   743 YSTVVRPICLPDATHVFPAGKAIWVTGWGHTKEGGTGALILQKGEIRVINQTTCEDLM-----PQ 802

  Fly  1620 KILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKP 1684
            :|....:|.|:.:|..|||:|||||||.....|||...||.||.|..||....||||.|....:.
Mouse   803 QITPRMMCVGFLSGGVDSCQGDSGGPLSSAEKDGRMFQAGVVSWGEGCAQRNKPGVYTRLPVVRD 867

  Fly  1685 WLRSITGV 1692
            |::..|||
Mouse   868 WIKEHTGV 875

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 88/251 (35%)
St14XP_036010597.1 SEA 108..198 CDD:396113
CUB 247..352 CDD:238001
CUB 360..464 CDD:238001
LDLa 474..506 CDD:238060
LDLa 512..543 CDD:238060
LDLa 545..579 CDD:238060
LDLa 587..622 CDD:238060
Tryp_SPc 635..872 CDD:238113 88/251 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.