DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and TMPRSS6

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_001275929.1 Gene:TMPRSS6 / 164656 HGNCID:16517 Length:824 Species:Homo sapiens


Alignment Length:330 Identity:102/330 - (30%)
Similarity:150/330 - (45%) Gaps:69/330 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1413 NGRKIHSTSRTLPTPNLAFH--------SPSTECGVRPHVKSG---------------RIVGGKG 1454
            ||.........:|.....|.        .|:.:|..||..:.|               |||||..
Human   509 NGSDEEQCQEGVPCGTFTFQCEDRSCVKKPNPQCDGRPDCRDGSDEEHCDCGLQGPSSRIVGGAV 573

  Fly  1455 STFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHC-QPGFLASLV---AVMGEFDISG 1515
            |:.|.:|||..      |.:..::.|||.||..|:||||||| |...:||.|   ..:|:.    
Human   574 SSEGEWPWQAS------LQVRGRHICGGALIADRWVITAAHCFQEDSMASTVLWTVFLGKV---- 628

  Fly  1516 DLESKR---SVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPICMPNDVADF-TGRM 1576
             .::.|   .|:..|.|:::|..::..:.:.|:|||:||.||.....:.|:|:|.....| .|..
Human   629 -WQNSRWPGEVSFKVSRLLLHPYHEEDSHDYDVALLQLDHPVVRSAAVRPVCLPARSHFFEPGLH 692

  Fly  1577 ATVTGWGRLKYGG----------------------GVPSVLQEVQVPIIENSVCQEMFHTAGHNK 1619
            ..:||||.|:.|.                      .:.:.||:|.|.:|...:|.|::     ..
Human   693 CWITGWGALREGALRADAVALFYGWRNQGSETCCCPISNALQKVDVQLIPQDLCSEVY-----RY 752

  Fly  1620 KILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKP 1684
            ::....|||||..|:||:|:||||||||.:...||:.|||.||.|:.|..|...|||.|.|....
Human   753 QVTPRMLCAGYRKGKKDACQGDSGGPLVCKALSGRWFLAGLVSWGLGCGRPNYFGVYTRITGVIS 817

  Fly  1685 WLRSI 1689
            |::.:
Human   818 WIQQV 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 92/269 (34%)
TMPRSS6NP_001275929.1 SEA 77..177 CDD:307516
CUB 326..440 CDD:238001
LDLa 450..480 CDD:238060
LDLa 486..516 CDD:238060 2/6 (33%)
Ldl_recept_a 520..557 CDD:278486 7/36 (19%)
Tryp_SPc 568..822 CDD:238113 92/269 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.