DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and F7

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_034302.2 Gene:F7 / 14068 MGIID:109325 Length:446 Species:Mus musculus


Alignment Length:273 Identity:99/273 - (36%)
Similarity:138/273 - (50%) Gaps:34/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1434 PSTE--CGVRPHV-------KSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRY 1489
            |..|  ||..|.|       :.||||||.....|..|||.:::.:   ||..   ||.||:.:|:
Mouse   170 PKVEYPCGRIPVVEKRNSSSRQGRIVGGNVCPKGECPWQAVLKIN---GLLL---CGAVLLDARW 228

  Fly  1490 VITAAHCQPG--FLASLVAVMGEFDIS---GDLESKRSVTKNVKRVIVHRQYDPATFENDLALLE 1549
            ::|||||...  :..::..||||.|.|   ||.:.:|     |.:||:..:|......:|:|||.
Mouse   229 IVTAAHCFDNIRYWGNITVVMGEHDFSEKDGDEQVRR-----VTQVIMPDKYIRGKINHDIALLR 288

  Fly  1550 LDSPVQFDTHIVPICMP------NDVADFTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVC 1608
            |..||.|..::||:|:|      |.:|..  |.:.|:|||:|...|.....|..::||.:....|
Mouse   289 LHRPVTFTDYVVPLCLPEKSFSENTLARI--RFSRVSGWGQLLDRGATALELMSIEVPRLMTQDC 351

  Fly  1609 QEMFHTAGHNKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLP 1673
            .|....:.:..||..:..||||.:|.||:|:||||||..... .|.:.|.|.||.|..|||....
Mouse   352 LEHAKHSSNTPKITENMFCAGYMDGTKDACKGDSGGPHATHY-HGTWYLTGVVSWGEGCAAIGHI 415

  Fly  1674 GVYMRTTFYKPWL 1686
            |||.|.:.|..||
Mouse   416 GVYTRVSQYIDWL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 91/249 (37%)
F7NP_034302.2 GLA 24..85 CDD:214503
EGF_CA 87..123 CDD:238011
FXa_inhibition 132..168 CDD:291342
Tryp_SPc 193..427 CDD:214473 90/247 (36%)
Tryp_SPc 194..431 CDD:238113 91/249 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.