DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and Prss28

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:253 Identity:76/253 - (30%)
Similarity:123/253 - (48%) Gaps:29/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1449 IVGGKGSTFGAYPWQVLVR-----ESTWLGLFTKNKCGGVLITSRYVITAAHC---QPGFLASLV 1505
            ||||:.:..|.:||||.:|     .::|:.:     |||.:|..::::|||||   |....|...
Mouse    31 IVGGQCTPPGKWPWQVSLRMYSYEVNSWVHI-----CGGSIIHPQWILTAAHCIQSQDADPAVYR 90

  Fly  1506 AVMGEFDISGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPICMPNDVA 1570
            ..:||..:     .|.....|:.|:|:|..|:..:...||||::|.:.:...|::.|:.:|.|.:
Mouse    91 VQVGEVYL-----YKEQELLNISRIIIHPDYNDVSKRFDLALMQLTALLVTSTNVSPVSLPKDSS 150

  Fly  1571 DFTGR-MATVTGWGRL--KYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNK----KILTSFLCA 1628
            .|... ...:.|||.|  :.....|..|.||::||.:|..|:..:.....::    .|....|||
Mouse   151 TFDSTDQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQDNKSCKRAYRKKSSDEHKAVAIFDDMLCA 215

  Fly  1629 GYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWL 1686
            |.:.  :..|.||||||||..: ..::...|.||.||.| :..||.::.|......|:
Mouse   216 GTSG--RGPCFGDSGGPLVCWK-SNKWIQVGVVSKGIDC-SNNLPSIFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 76/253 (30%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 76/253 (30%)
Tryp_SPc 31..269 CDD:214473 75/251 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843008
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.