DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and mst1

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:XP_004915630.2 Gene:mst1 / 100494056 XenbaseID:XB-GENE-487985 Length:736 Species:Xenopus tropicalis


Alignment Length:272 Identity:74/272 - (27%)
Similarity:118/272 - (43%) Gaps:36/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1428 NLAFHSPSTECGVRPHVKS--GRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYV 1490
            |:.|.|    ||.|....|  .|||||..   |..||.|.:|...     .::.|||.|:...:|
 Frog   487 NIVFDS----CGKRNDRSSQRTRIVGGMP---GNSPWTVSLRNRQ-----GEHFCGGSLVKENWV 539

  Fly  1491 ITAAHCQPGF---LASLVAVMGEF--DISGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLEL 1550
            |:...|....   |:...||||..  :.|.|...::||.  :.:::.    .|:  ::.|.:|:|
 Frog   540 ISTRQCFSSCDADLSGYQAVMGTLFKNPSPDDPDRQSVP--ISKIVC----GPS--DSSLVMLKL 596

  Fly  1551 DSPVQFDTHIVPICMPND---VADFTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEMF 1612
            :.||..::.:..||:|.:   |.:.|  ...:.|||... |.|..:||:.....||.|..|.:.:
 Frog   597 ERPVTLNSRVALICLPPERYIVPEAT--KCEIAGWGDTG-GTGHDNVLKIAIFHIISNDECNKNY 658

  Fly  1613 HTAGHNKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYM 1677
            .:  ...|:|.:.:|.........:||||.||||.....| .:.|.|.:.....|.....|.::.
 Frog   659 RS--QRNKVLDNEMCTKPVPVDVGACEGDYGGPLACLTHD-CWVLEGVIVPARGCGKKNQPAIFT 720

  Fly  1678 RTTFYKPWLRSI 1689
            |.:.|..|:..:
 Frog   721 RVSVYVDWINKV 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 66/247 (27%)
mst1XP_004915630.2 PAN_AP_HGF 36..114 CDD:238532
KR 118..198 CDD:214527
KR 201..279 CDD:214527
KR 308..390 CDD:214527
KR 397..474 CDD:412161
Tryp_SPc 506..732 CDD:238113 66/247 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.