DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flz and tmprss3a

DIOPT Version :9

Sequence 1:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster
Sequence 2:XP_021334565.1 Gene:tmprss3a / 100000148 ZFINID:ZDB-GENE-070912-70 Length:543 Species:Danio rerio


Alignment Length:285 Identity:102/285 - (35%)
Similarity:146/285 - (51%) Gaps:37/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1416 KIH---STSRTLPTPNLAFHSPSTECGVRPHVKSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTK 1477
            |||   ::|:|..:..:........||.||.. |.|||||..|..|.:||||        .|..:
Zfish   263 KIHNITNSSKTKCSLGMVTALKCIACGSRPKF-SARIVGGNLSAEGQFPWQV--------SLHFQ 318

  Fly  1478 NK--CGGVLITSRYVITAAHCQPGFLASLVAVMGEFDISGDLESKRSVTK--NVKRVIVHRQYDP 1538
            |:  |||.:||||:::|||||..|....:..::    .:|..|...:..|  .|:::|.|.:|.|
Zfish   319 NEHLCGGSIITSRWILTAAHCVYGIAYPMYWMV----YAGLTELPLNAVKAFAVEKIIYHSRYRP 379

  Fly  1539 ATFENDLALLELDSPVQFDTHIVPICMPNDVADF-TGRMATVTGWGRLKYGGGVPSVLQE-VQVP 1601
            ...::|:||::|..|:.|:..:.|||:||....| .|:|..::|||..:.||.. ||.|. ..||
Zfish   380 KGLDHDIALMKLAQPLTFNGMVEPICLPNFGEQFEDGKMCWISGWGATEDGGDA-SVSQHCASVP 443

  Fly  1602 IIENSVCQEM-----FHTAGHNKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTV 1661
            :|.|..|.:.     :.|||        .:||||.:|..|||:|||||||..: ....::|.|..
Zfish   444 LISNKACSQPEVYQGYLTAG--------MICAGYLDGGTDSCQGDSGGPLACE-DSSIWKLVGAT 499

  Fly  1662 SHGIKCAAPYLPGVYMRTTFYKPWL 1686
            |.|..||....||||.|.|....|:
Zfish   500 SWGQGCAEKNKPGVYTRITQSLTWI 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 91/249 (37%)
tmprss3aXP_021334565.1 LDLa 154..186 CDD:238060
SRCR_2 191..292 CDD:317845 7/28 (25%)
Tryp_SPc 298..525 CDD:238113 91/249 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.