DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spab and dkk2

DIOPT Version :9

Sequence 1:NP_610434.1 Gene:spab / 35901 FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001104679.1 Gene:dkk2 / 792404 ZFINID:ZDB-GENE-080204-14 Length:243 Species:Danio rerio


Alignment Length:245 Identity:47/245 - (19%)
Similarity:73/245 - (29%) Gaps:94/245 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LDPSLAASASSFASGNAWQRALFGRESRNLMHRRAPFSGAADLGLDEYLGPYGAVEQEQHQP-HP 83
            |:|..||:..|.||.:...:      ..|:..:..|.|...:..:..|.          |.| |.
Zfish    40 LEPQPAAANRSGASYSGIPK------KSNIPAQGYPCSSDKECVVGTYC----------HSPQHA 88

  Fly    84 PPQQMRQQTEVYGIVEPLIEDTPCADRP--CLLNDDCCPSGVCVSTY------------------ 128
            |.:::                 .|..|.  |..::.|||...| |.|                  
Zfish    89 PSRRL-----------------SCRRRKKRCHRDNMCCPGNRC-SNYICIPISESALSSHKSSMD 135

  Fly   129 -------------GEGKC---VYVFGRQRDLCQGHADCPQGSSCMLVPQEGAWR--CEPSVESGG 175
                         ..||.   :.:.|.:.|.|...:||.:|..|    ....|.  |:|.:..| 
Zfish   136 ENNKFSIKEKNWKKNGKAHAKISLKGHEGDPCLRSSDCSEGYCC----ARHFWTKICKPVLRQG- 195

  Fly   176 STSLLEGIFGAKERQPLGSECSSSSDCQVINGMCCQ---------QQRLH 216
                 |.....:::...|.|.....||  ..|:.|:         :.|||
Zfish   196 -----EVCTKQRKKGSHGLEIFQRCDC--AKGLACKVWKDATSFSRSRLH 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spabNP_610434.1 None
dkk2NP_001104679.1 Dickkopf_N 70..120 CDD:282549 15/77 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1139517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.